PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj3g3v0667930.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family NAC
Protein Properties Length: 210aa    MW: 23633.8 Da    PI: 9.6745
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj3g3v0667930.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM163.11e-50161411128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGfrF Pt+eel+v+y+++kv+g++++l  +i+e+d+yk++Pw Lp+k+  +ekewyfFs+rd+ky++g+r+nr++ sgyWkatg+dk +++
  Lj3g3v0667930.1  16 LPPGFRFYPTEEELLVQYICRKVAGHNFTL-PIIAEIDLYKFDPWVLPSKAIFGEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKIITT 108
                      79*************************999.88***************7777799***********************************9999 PP

              NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       +g++vg+kk Lvfy g+apkg+kt+W+mheyrl
  Lj3g3v0667930.1 109 -EGRKVGIKKALVFYVGKAPKGTKTNWIMHEYRL 141
                      .999****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-6612165IPR003441NAC domain
PROSITE profilePS5100559.38716164IPR003441NAC domain
PfamPF023652.1E-2517141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009414Biological Processresponse to water deprivation
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 210 aa     Download sequence    Send to blast
MTMGIPEKDP LSQLSLPPGF RFYPTEEELL VQYICRKVAG HNFTLPIIAE IDLYKFDPWV  60
LPSKAIFGEK EWYFFSPRDR KYPNGSRPNR VAGSGYWKAT GTDKIITTEG RKVGIKKALV  120
FYVGKAPKGT KTNWIMHEYR LLDSSQKNTG SRLDDWVLCR IYKKNSSAQR AASNGTVSSR  180
EYTQYSNGSS SSSSSHLDDV MESLPEIGGG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-10831704171NO APICAL MERISTEM PROTEIN
1ut4_B1e-10831704171NO APICAL MERISTEM PROTEIN
1ut7_A1e-10831704171NO APICAL MERISTEM PROTEIN
1ut7_B1e-10831704171NO APICAL MERISTEM PROTEIN
3swm_A1e-10831707174NAC domain-containing protein 19
3swm_B1e-10831707174NAC domain-containing protein 19
3swm_C1e-10831707174NAC domain-containing protein 19
3swm_D1e-10831707174NAC domain-containing protein 19
3swp_A1e-10831707174NAC domain-containing protein 19
3swp_B1e-10831707174NAC domain-containing protein 19
3swp_C1e-10831707174NAC domain-containing protein 19
3swp_D1e-10831707174NAC domain-containing protein 19
4dul_A1e-10831704171NAC domain-containing protein 19
4dul_B1e-10831704171NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.65970.0cell culture| floral bud| flower| pod| protoplast| root
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00360DAPTransfer from AT3G15500Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014505280.11e-138PREDICTED: NAC domain-containing protein 72-like
SwissprotQ9LDY81e-114NAC55_ARATH; NAC domain-containing protein 55
TrEMBLA0A0S3SIA71e-137A0A0S3SIA7_PHAAN; Uncharacterized protein
TrEMBLA0A0L9ULN01e-137A0A0L9ULN0_PHAAN; Uncharacterized protein
STRINGGLYMA12G35000.11e-134(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44293360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15500.11e-114NAC domain containing protein 3